Portal de Periódicos da CAPES

Shock Caused by Gram-negative Microorganisms

1964; American College of Physicians; Volume: 60; Issue: 3 Linguagem: Inglês

10.7326/0003-4819-60-3-384

1539-3704

Max Harry Weil,

Trauma, Hemostasis, Coagulopathy, Resuscitation

Article1 March 1964Shock Caused by Gram-negative MicroorganismsAnalysis of 169 CasesMAX HARRY WEIL, M.D., F.A.C.P., HERBERT SHUBIN, M.D., F.A.C.P., MARJORIE BIDDLE, PH.D.MAX HARRY WEIL, M.D., F.A.C.P.Search for more papers by this author, HERBERT SHUBIN, M.D., F.A.C.P.Search for more papers by this author, MARJORIE BIDDLE, PH.D.Search for more papers by this authorAuthor, Article, and Disclosure Informationhttps://doi.org/10.7326/0003-4819-60-3-384 SectionsAboutPDF ToolsAdd to favoritesDownload CitationsTrack CitationsPermissions ShareFacebookTwitterLinkedInRedditEmail ExcerptA syndrome that is characterized by acute hypotension and shock and occurs during the course of bacteremia due to gram-negative microorganisms was described in 1951 (1, 2). Since then there has been an increasing interest in this entity and in experimental models in which shock is produced in laboratory animals by injection of endotoxin derived from gram-negative bacteria. Initially regarded as a relatively rare occurrence, reports of more than 200 cases in the past decade indicate that this is a common complication in both medical and surgical patients (3-11).In 1958, Spink and one of the present authors (5) reported...References1. WAISBREN BA: Bacteremia due to gram-negative bacilli other than the Salmonella: clinical and therapeutic study. Arch. Intern. Med. (Chicago) 88: 467, 1951. CrossrefGoogle Scholar2. BORDENHALL CWWH: Fatal transfusion reactions from massive bacterial contamination of blood. New Eng. J. Med. 245: 760, 1951. CrossrefMedlineGoogle Scholar3. BRAUDESIEMIENSKIWILLIAMSSANFORD AIJDJP: Overwhelming bacteremic shock produced by gram-negative bacilli: a report of four cases with one recovery. Univ. Mich. Med. Bull. 19: 23, 1953. Google Scholar4. STEVENSLEGGHENRYDILLEKIRBYFINCH ARJSBSJMWMCA: Fatal transfusion reactions from contamination of stored blood by cold growing bacteria. Ann. Intern. Med. 39: 1228, 1953. LinkGoogle Scholar5. WEILSPINK MHWW: The shock syndrome associated with bacteremia due to gram-negative bacilli. Arch. Intern. Med. (Chicago) 101: 184, 1958. CrossrefGoogle Scholar6. MCHENRYMARTIN MCWJ: Bacteremic shock due to gram-negative enteric coli. Proc. Mayo Clin. 37: 162, 1962. Google Scholar7. WISESHAFFERSPINK RIJMWW: The syndrome of vascular collapse due to gram-negative bacteria: its management with l-norepinephrine and antibiotics. J. Lab. Clin. Med. 40: 961, 1952. Google Scholar8. HALLGOLD WHD: Shock associated with bacteremia. Arch. Intern. Med. (Chicago) 96: 403, 1955. CrossrefGoogle Scholar9. EBERT RV: The mechanism and treatment of shock associated with infection. Southern Med. J. 49: 485, 1956. CrossrefMedlineGoogle Scholar10. DUNNNICHOLS WJDR: Bacteremic shock. Proc. Mayo Clin. 31: 333, 1956. MedlineGoogle Scholar11. SPITTELMARTINNICHOLS JAWJDR: Bacteremia owing to gram-negative bacilli. Experiences in the treatment of 137 patients in a 15 year period. Ann. Intern. Med. 44: 302, 1956. LinkGoogle Scholar12. HANNIGANLAFAMMESHIELDS CAPJDR: The gram-negative bacteremia shock syndrome. J. Maine Med. Assoc. 51: 77, 1960. MedlineGoogle Scholar13. FISHER RA: Statistical methods for research workers. Haffner Publishing Company, New York, 1948. Google Scholar14. ANDERSONKADNER GVM: Septic abortion with vascular collapse. Western J. Surg. 69: 129, 1961. MedlineGoogle Scholar15. DEANERUSSELL RMKP: Enterobacillary septicemia and bacterial shock in septic abortion. Amer. J. Obstet. Gynec. 79: 528, 1960. CrossrefMedlineGoogle Scholar16. MCHENRYMARTINWELLMAN MCWJWE: Bacteremia due to gram-negative bacilli. Ann. Intern. Med. 56: 207, 1962. LinkGoogle Scholar17. SHUBINWEIL HMH: Acute elevation of serum transaminase and lactic dehydrogenase during circulatory shock. Amer. J. Cardiol. 11: 327, 1963. CrossrefMedlineGoogle Scholar18. WESTPHAL O: Pyrogens, in Polysaccharides in Biology. Trans. Second Conf. April 25, 26, 27, 1956, Princeton, N. J. Edited by SPRINGER, G. F., Josiah Macy, Jr. Foundation, 1957, p. 117. Google Scholar19. RIBIHOYERMILNERPREENLARSONGOODE EBHCTDCLG: Physical and chemical analysis of endotoxin from Salmonella enteritides. J. Immunol. 84: 32, 1960. Google Scholar20. VAN HEYNINGEN WF: Bacterial toxins. Blackwell, Oxford, England, 1950. Google Scholar21. SPINKANDERSON WWD Experimental studies on the significance of endotoxin in the pathogenesis of Brucellosis. J. Clin. Invest. 33: 540, 1954. CrossrefMedlineGoogle Scholar22. SPINK WW: From endotoxin to snake venom. Yale J. Biol. Med. 30: 1957-58. Google Scholar23. ROSEN FS: The endotoxins of gram-negative bacteria and host resistance. New Eng. J. Med. 264: 919, 1961. CrossrefMedlineGoogle Scholar24. UDHOJIWEILSAMBHIROSOFF VNMHMPL: Hemodynamic studies on clinical shock associated with infection. Amer. J. Med. 34: 461, 1963. CrossrefMedlineGoogle Scholar25. MCKAYJEWETTREID DGJFDE: Endotoxin shock and the generalized Schwartzman reaction in pregnancy. Amer. J. Obstet. Gynec. 78: 546, 1959. CrossrefGoogle Scholar26. SPINKBRAUDECASTANEDASILVA WWAIMRGR: Aureomycin therapy in human brucellosis due to Brucella melitensis. JAMA 138: 1145, 1948. CrossrefMedlineGoogle Scholar27. EBERTABERNATHY RVRS: Septic shock. Fed. Proc. 20: 179, 1961. MedlineGoogle Scholar28. MELBYEGDAHLSPINK JCRHWW: Effect of Brucella endotoxin on adrenocortical function in the dog. Fed. Proc. 16: 425, 1957. Google Scholar29. MELBYSPINK JCWW: Comparative studies on adrenal cortical function and cortisol metabolism in healthy adults and in patients with shock due to endotoxin. J. Clin. Invest. 37: 1791, 1958. CrossrefMedlineGoogle Scholar30. HOKFELTBYGDEMANSEKKENES BSJ: The participation of the adrenal glands in endotoxin shock, in Shock, Pathogenesis and Therapy, edited by BOCK, K. D., Academic Press, New York, 1962, p. 151. Google Scholar31. WEILALLEN MHKS: The effects of steroids on shock due to endotoxin, in Inflammation and Diseases of Connective Tissues. A Hahnemann Symposium, edited by MOYER, L. C., and MOYER, J. H., W. B. Saunders Company, Philadelphia, 1961, p. 768. Google Scholar32. KINSELL LW: Nutritional and metabolic aspects of infection. Ann. NY Acad. Sci. 63: 240, 1955. CrossrefMedlineGoogle Scholar33. SPINK WW: The pathogenesis and management of shock due to infection. Arch. Intern. Med. (Chicago) 106: 433, 1960. CrossrefMedlineGoogle Scholar34. SPINK WW: Adrenocortical steroids in the management of selected patients with infectious diseases. Ann. Intern. Med. 53: 1, 1960. LinkGoogle Scholar35. SPINK WW: ACTH and adrenocortical steroids in the management of selected patients with infectious diseases. Trans. Amer. Clin. Climat. Ass. 71: 202, 1959. MedlineGoogle Scholar36. WEIL MH: The cardiovascular effects of corticosteroids. Circulation 25: 718, 1962. CrossrefMedlineGoogle Scholar37. WEIL MH: Current concepts in the management of shock. Circulation 16: 1097, 1957. CrossrefMedlineGoogle Scholar38. SAMBHIWEILUDHOJI MPMHVN: Increase in cardiac output: a pharmacologic effect of corticosteroids. Circulation 26: 780, 1962. Google Scholar39. LILLEHEIMACLEAN RCLD: The intestinal factor in irreversible endotoxin shock. Ann. Surg. 148: 513, 1958. CrossrefMedlineGoogle Scholar40. LILLEHEIMACLEAN RCLD: Physiological approach to successful treatment of endotoxin shock in the experimental animal. Arch. Surg. (Chicago) 78: 464, 1959. CrossrefGoogle Scholar41. WEILHINSHAWVISSCHERSPINKMACLEAN MHLBMBWWLD: Hemodynamic effects of vasopressor agent (metaramnamic on hypotension in dogs produced by endotoxin. Proc. Soc. Exp. Biol. Med. 92: 610, 1956. CrossrefMedlineGoogle Scholar42. SAMBHIWEILUDHOJIROSOFF MPMHVNL: A comparison between hemodynamic effects of norepinephrine and corticosteroids in shock. Clin. Res. Proc. 11: 73, 1963. Google Scholar43. ZWEIFACHTHOMAS BWL: Relationship between the vascular manifestations of shock produced by endotoxins, trauma and hemorrhage. I. Certain similarities between the reactions in normal and endotoxin-tolerant rats. J. Exp. Med. 106: 385, 1957. CrossrefMedlineGoogle Scholar44. ZWEIFACH BW: Functional deterioration of terminal vascular bed in irreversible hemorrhagic shock. Ann. NY Acad. Sci. 55: 370, 1952. CrossrefMedlineGoogle Scholar45. LILLEHEILONGERBEAMROSENBERG RCJKJC: The nature of irreversible shock; its relationship to intestinal changes, in Shock, Pathogenesis and Therapy, edited by BOCK, K. D., Academic Press, New York, 1962, p. 106. Google Scholar46. DELAUNAYBOUQUETLEBRUNLEHOUTDELAUNAY ARJYM: Le mode d'action des endotoxines bacteriennes, les troubles vaso, motems chez les animaux intoxiques et leurs consequences. J. de Physiol. (Paris) 40: 89, 1948. Google Scholar47. NICKERSON M: Factors of vascoconstriction and vasodilation in shock. J. Mich. Med. Soc. 54: 45, 1955. MedlineGoogle Scholar48. HARDY JD: Mechanisms of shock in peritonitis. J. Surg. Res. 1: 64, 1961. CrossrefMedlineGoogle Scholar49. WEILSAMBHIUDHOJIROSOFFSUDRANN MHMPVNLRB: Effect of vasopressor therapy on cardiac output in patients with acute hypotension. Clin. Res. Proc. 10: 182, 1962. Google Scholar50. WEILMILLER MHB: Experimental studies on therapy of circulatory failure produced by endotoxin. J. Lab. Clin. Med. 57: 683, 1961. MedlineGoogle Scholar51. NICKERSONCARTER MSA: Protection against acute trauma and traumatic shock by vasodilators. Canad. J. Biochem. 37: 1161, 1959. MedlineGoogle Scholar52. NICKERSON M: Drug therapy of shock, in Shock, Pathogenesis and Therapy, edited by BOCK, K. D., Academic Press, New York, 1962, p. 356. Google Scholar53. HOULEWEILBROWNCAMPBELL DBMHEBGS: Influence of respiratory acidosis on ECG and pressor responses to epinephrine, norepinephrine and metaraminol. Proc. Soc. Exp. Biol. Med. 94: 561, 1957. CrossrefMedlineGoogle Scholar54. WEILHOULEBROWNCAMPBELLHEATH MHDBEBGSC: Vasopressor agents: influence of acidosis on cardiac and vascular responsiveness. Calif. Med. 88: 437, 1958. MedlineGoogle Scholar55. WEIL MH: Endotoxin shock. Clin. Obstet. Gynec. 4: 971, 1961. CrossrefGoogle Scholar56. SPINK WW: Pathogenesis and therapy of shock due to infection: experimental and clinical studies, in Shock, Pathogenesis and Therapy, edited by BOCK, K. D., Academic Press, New York, 1962, p. 225. Google Scholar57. BEIN HJ: Aldosterone and alterations in circulatory reactivity following endotoxins, in Shock, Pathogenesis and Therapy, edited by BOCK, K. D., Academic Press, New York, 1962, p. 162. Google Scholar58. CROCKETTGOODWIN ATWE: Bacteremic shock: hypothermia as a therapeutic adjunct. Surg. Forum 10: 383, 1959. Google Scholar59. ALLENESTESMANSBERGER JMJTAR: The use of hypothermia in septic shock. Amer. Surgeon 26: 11, 1960. MedlineGoogle Scholar60. HARDAWAYHUSNIGEEVERNOYESBURNS RMEAEFHEJU: Endotoxin shock. A manifestation of intravascular coagulation. Ann. Surg. 154: 791, 1961. CrossrefMedlineGoogle Scholar61. HARDAWAYBARILLABURNESMOCK RMTGJWHP: Studies on pH changes in endotoxin and hemorrhagic shock. J. Surg. Res. 1: 278, 1961. CrossrefMedlineGoogle Scholar62. WEILUDHOJIALLEN MHVNKS: The head down position in treatment of shock. Surg. Gynec. Obstet. 116: 669, 1963. MedlineGoogle Scholar This content is PDF only. To continue reading please click on the PDF icon. Author, Article, and Disclosure InformationAuthors: MAX HARRY WEIL, M.D., F.A.C.P.; HERBERT SHUBIN, M.D., F.A.C.P.; MARJORIE BIDDLE, PH.D.Affiliations: Los Angeles, CaliforniaFrom the Department of Medicine, University of Southern California School of Medicine and the Los Angeles County Hospital, Los Angeles, California.Supported by the American and the Los Angeles County Heart Associations, by National Heart Institute grant H-5570, and by The John A. Hartford Foundation, Inc., New York.Requests for reprints should be addressed to Max Harry Weil, M.D., Department of Medicine, University of Southern California, School of Medicine, 2025 Zonal Avenue, Los Angeles 90033, California. PreviousarticleNextarticle Advertisement FiguresReferencesRelatedDetails Metrics Cited byTrauma sepsisOrgan dysfunction during sepsisCecal Ligation and Incision: An Acute Onset Model of Severe Sepsis in RatsClinical sepsisOrgan dysfunction during sepsisTransrectal biopsy of the prostate and bacteraemiaCardiovascular management of septic shockMyocardial dysfunction in the patient with sepsisMyocardial dysfunction in septic shock: Part II. Role of cytokines and nitric oxideMyocardial dysfunction in septic shock: Part I. Clinical manifestation of cardiovascular dysfunctionThe haemodynamics of human septic shock*Infectious Diseases and AgingInhibition of LPS-induced Cytokines by Bcl-xL in a Murine Macrophage Cell LineNorepinephrine: No more “leave ’em dead”?MYOCARDIAL DYSFUNCTION IN SEPTIC SHOCKHas the mortality of septic shock changed with time?Lipopolysaccharide and Ceramide Use Divergent Signaling Pathways to Induce Cell Death in Murine MacrophagesSteroid controversy in sepsis and septic shockInduction of early gene expression in murine macrophages by synthetic lipid A analogs with differing endotoxic potentialsClinical Manifestations of Cardiovascular Dysfunction in SepsisDefinitions for Sepsis and Organ Failure and Guidelines for the Use of Innovative Therapies in SepsisMyocardial Infarction Mimicked by Acute CholecystitisEdward T. Ryan, MD, Peter H. Pak, MD, Roman W. DeSanctis, MDSeptic abortion at University College Hospital, Ibadan, NigeriaThe HA-1A Monoclonal Antibody for Gram-Negative SepsisCardiovascular Dysfunction in Septic ShockSeptic Shock in Humans Advances in the Understanding of Pathogenesis, Cardiovascular Dysfunction, and TherapyJoseph E. Parrillo, MD, Margaret M. Parker, MD, Charles Natanson, MD, Anthony F. Suffredini, MD, Robert L. Danner, MD, Robert E. Cunnion, MD, Frederick P. Ognibene, MDMyocardial function in septic shockSeptic shockBacterial Septic ShockThe role of low molecular weight dextran on platelet pulmonary trapping during endotoxin-induced shockCardiorespiratory patterns in viral septicemiaEndotoxin-polluted medium in a human in vitro fertilization programEndotoxemia in intensive care patients: A longitudinal study with the limulus amebocyte lysate testRevisión de temas. Tratamiento del Shock Séptico sin Drogas VasopresorasNeisseria subflava endocarditisSepticaemia in a medical intensive care unit. Clinical, biochemical and microbiological data of 109 casesGeriatric Infectious DiseasesAcute and Transient ST Segment Elevation During Bacterial Shock in Seven Patients Without Apparent Heart DiseaseGLUCOCORTICOIDS IN THE TREATMENT OF SHOCK AND THE ADULT RESPIRATORY DISTRESS SYNDROMESeptic Shock in Neonates, Infants, and ChildrenIn vivo AND in vitro EFFECTS OF ENDOTOXIN ON PROSTAGLANDIN RELEASE FROM RAT LUNGDetermination of anti-lipid A and lipid A by enzyme immunoassaySuccessful management of iliac mycotic aneurysm secondary to klebsiella endocarditis —Report of a caseSchockbehandlung bei Sepsis und Intoxikationen unter besonderer Berücksichtigung von Katecholaminen und VasodilatantienGram-negative bacteremiaBacteriaemia and Bacteriogenic Shock in District Hospital Urological PracticeTratamiento del Shock Séptico sin drogas vasopresorasHemodynamic Defects Underlying Shock with Indications for Treatment: An Appraisal of Vasopressors and VasodilatorsChemotherapy of Gram-negative Bacillary InfectionsTREATMENT OF SEPTICAEMIA IN THE NEWBORN INFANT: CHOICE OF INITIAL ANTIMICROBIAL DRUGS AND THE ROLE OF EXCHANGE TRANSFUSIONSepticaemia in the Tropics: A Prospective Epidemiological Study of 146 Patients with a High Case Fatality RateBacterial shockHospitalismus in der speziellen Urologie — Ein technologisches Problem?Pseudomonas bacteremiaHistamine Hypersensitivity in Mice Induced by Bacterial EndotoxinsThe clinical manifestation of endotoxic shock arising from high level contaminationGlucocorticoid Therapy in Sepsis/Shock Caused by Gram-Negative Microorganisms†Sepsis and hypercalcemiaIncidence of Gram-Negative-Rod BacteremiaTod und Gesundheitsbeschädigung durch von außen kommende EinwirkungenSome Aspects of the Effects of Endotoxin on the Central Nervous SystemClinical Features in Shock Associated with Gram-Negative BacteremiaClinical Trial Design in Studies of Corticosteroids for Bacterial InfectionsSTEPHEN WEITZMAN, M.D., STEPHEN BERGER, M.D.Corticosteroids and Experimental Intravascular CoagulationThe Role of Assisted Circulation in the Management of Endotoxic ShockSepticaemic shock. Report of three cases: a review of diagnosis and managementSeptic shock: Hemodynamics of endotoxin and inflammationBacteræmic ShockCorticosteroid therapy in traumatic shockBubonic Plague: Detection of Endotoxemia with the Limulus TestTHOMAS BUTLER, M.D., JACK LEVIN, M.D., F.A.C.P., DO QUANG CU, M.D., R. I. WALKER, Ph.D.Gram-Negative Bacteremic ShockShould Corticosteroids Be Used in Shock?Hemodynamic studies and results of therapy in 50 patients with bacteremic shockRecognition and management of SHOCK in pediatric patientsComplications of colonic and rectal surgery: Results of a study of early presumptive antimicrobial therapy of serious infections in surgical patients with intestinal diseasesIatrogenic urosepsisChoque sépticoGram-Negative Sepsis: Detection of Endotoxemia with the Limulus Test With Studies of Associated Changes in Blood Coagulation, Serum Lipids, and ComplementJACK LEVIN, M.D., F.A.C.P., T. EDWIN POORE, M.D., NEAL S. YOUNG, M.D., SIMEON MARGOLIS, M.D., NEIL P. ZAUBER, M.D., ALEXANDER S. TOWNES, M.D., F.A.C.P., WILLIAM R. BELL, M.D.Pathophysiology and Management of Septic ShockSepticemia in surgical patients with intestinal diseasesPathophysiology of gram-negative shockBacteraemia in patients receiving human cadaveric renal transplantsKlinik und antibiotische Therapie der bakteriellen septischen Erkrankungen in der inneren MedizinTreatment of gram-negative shockSepticaemia in the burned patientSepticaemia—The forgotten complication of paraplegiaOccasional Review: Septic Abortion with Endotoxic ShockOsteomyelitis: A Review of Clinical Features, Therapeutic Considerations and Unusual AspectsOrgan dysfunction during sepsisGram-Negative SepticæmiaGram-Negative SepticæmiaGram-Negative SepticæmiaGram-negative septicaemia during haemorrhage from an anastomotic ulcerReferencesIntensive treatment of obstetric sepsisInfección pélvica en Obstetricia y Ginecología. Revisión estadística sobre 490 casosProvidence bacillus bacteremia and septicopyemiaRecovery following prolonged gram-negative shock and “shock lung”The Sympathetic Nervous System and Alpha Adrenergic Blocking Agents in ShockTHE CAUSE OF DEATH FOLLOWING ABORTION. AN ANALYSIS OF 28 CONSECUTIVE CASES AT GROOTE SCHUUR HOSPITALENDOTOXIC SHOCK AND HYPERPYREXIA IN UROLOGICAL PRACTICEEscherichia Coli Meningitis in Adults: Neurosurgical and Neuropathological ConsiderationsThe Chemotherapy of Enterobacterial InfectionsKlinik und Therapie des akuten Nierenversagens unter Berücksichtigung des EndotoxinschocksDeep Electrical Burn Complicated by Anuria and Pseudomonas SepticaemiaIn Vitro Effectiveness of Kanamycin and Kanamycin/Cephalothin Against KlebsiellaComparison with Other AntibioticsROGER J. BULGER, M.D.An essay regarding pathogenesis and treatment of shock due to bacteremia with special reference to “gram-negative” shockClostridium welchii bacteraemia: a case report with survival and review of the literatureHAFNIA: AN UNUSUAL CAUSE OF POSTOPERATIVE GRAM‐NEGATIVE BACTERIÆMIAThe Klebsiella-Enterobacter-Serratia Division Clinical and Epidemiologic CharacteristicsBRUCE W. STEINHAUER, M.D., THEODORE C. EICKHOFF, M.D., JAY WARD KISLAK, M.D., MAXWELL FINLAND, M.D., F.A.C.P.Clinical management of septic abortion complicated by hypotensionGram-Negative Bacteremia: An Evaluation of Fifty-Nine Cases During 1963Bacterial shock in obstetrics and gynecologyThe Treatment of Infections in Patients with Neoplasia Undergoing SurgeryCurrent status of the shock problemRESPIRATORY ACIDOSIS IN BRONCHIAL ASTHMABACTERÆMIC SHOCKGram-negative rod bacteremiaShockTherapy of Infections Caused by Gram-Negative BacilliIntestinal gangrene without apparent vascular occlusionHemodynamic and Metabolic Studies on Shock Associated with Bacteremia Observations on 16 PatientsVASANT N. UDHOJI, M.B., B.S., MAX HARRY WEIL, M.D., PH.D., F.A.C.P. 1 March 1964Volume 60, Issue 3Page: 384-400KeywordsBacteremiaEndotoxinsEscherichia coliGram negative bacteriaHeartHospital medicineHypotensionResearch laboratoriesShockUrinary tract infections ePublished: 1 December 2008 Issue Published: 1 March 1964 PDF downloadLoading ...