Low loss dielectric materials for LTCC applications: a review
2008; Taylor & Francis; Volume: 53; Issue: 2 Linguagem: Inglês
10.1179/174328008x277524
ISSN1743-2804
AutoresM. T. Sebastian, Heli Jantunen,
Tópico(s)Electrical and Thermal Properties of Materials
ResumoAbstractSmall, light weight and multifunctional electronic components are attracting much attention because of the rapid growth of the wireless communication systems and microwave products in the consumer electronic market. The component manufacturers are thus forced to search for new advanced integration, packaging and interconnection technologies. One solution is the low temperature cofired ceramic (LTCC) technology enabling fabrication of three-dimensional ceramic modules with low dielectric loss and embedded silver electrodes. During the past 15 years, a large number of new dielectric LTCCs for high frequency applications have been developed. About 1000 papers were published and ∼500 patents were filed in the area of LTCC and related technologies. However, the data of these several very useful materials are scattered. The main purpose of this review is to bring the data and science of these materials together, which will be of immense help to researchers and technologists all over the world. The commercially available LTCCs, low loss glass phases and researched novel materials are listed with properties and references. Additionally, their high frequency and thermal performances are compared with the other substrate material options such as high sintering temperature ceramics and polymers, and further improvements in materials' development required are discussed.Keywords: LTCCDIELECTRICSHRINKAGEGLASSPERMITTIVITYQ VALUETEMPERATURE COMPENSATIONCONSTRAINT SINTERING
Referência(s)